DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and HADHB

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_000174.1 Gene:HADHB / 3032 HGNCID:4803 Length:474 Species:Homo sapiens


Alignment Length:429 Identity:133/429 - (31%)
Similarity:216/429 - (50%) Gaps:53/429 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPIGSFNGTLSK-LKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPA 66
            :|.:|...|||. ..:||..| |...||....:..:|.|.:|..:.|:.:|.|..:...:..|.|
Human    53 NVVVVDGVRTPF-LLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVA 116

  Fly    67 RQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQGV 131
            |:|:|.||...:.||:.:.|.|.|..:.:..|...|.||...::||||.|.||..| :.|.|:..
Human   117 REAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVP-IRHSRKMR 180

  Fly   132 KMGPGTMVD-----------SMIH-----------DGLTDAMENIHMGITAENLADKYNISREAQ 174
            |:    |:|           |:|.           ..:::...:..||.:|:.||..:.:||..|
Human   181 KL----MLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQ 241

  Fly   175 DAYAVLSQNRAEEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGG 238
            |.||:.|.:.|::||.:|.. .::||.::   .|..|.:||..|:. |::|.:.||:.|| |..|
Human   242 DEYALRSHSLAKKAQDEGLL-SDVVPFKV---PGKDTVTKDNGIRP-SSLEQMAKLKPAFIKPYG 301

  Fly   239 SITAGNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPK-VMGLGPVTAVEALLQKI 302
            ::||.|:|.:.|.|:|:|:|:.|:....|.||.|.:..:.....:|| .:.|||..|...:|:|.
Human   302 TVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKA 366

  Fly   303 NWKREEVDLYELNEAFAAQSLAVLQDLQLD-----------------AQKVNVNGGAIALGHPIG 350
            .....::|.:|.:|||:.|.||..:.:..|                 .:|.|..||:::||||.|
Human   367 GLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPFG 431

  Fly   351 ASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            |:|.|:::.....|.:.||:.|:.:.|..||.|.|:.||
Human   432 ATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 133/429 (31%)
thiolase 5..390 CDD:238383 132/427 (31%)
HADHBNP_000174.1 thiolase 55..471 CDD:238383 132/427 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.