DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and Hadhb

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001276727.1 Gene:Hadhb / 231086 MGIID:2136381 Length:475 Species:Mus musculus


Alignment Length:431 Identity:133/431 - (30%)
Similarity:212/431 - (49%) Gaps:53/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVFIVSAARTPIGSFNGTLSK-LKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQN 64
            |.::.:|...|.|. ..:||..| |...||....:..:|.|.|:....|:.:|.|..:...:..|
Mouse    52 MKNIVVVEGVRIPF-LLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSN 115

  Fly    65 PARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQ 129
            .||:|:|.||...:.||:.:.|.|.|..:.:......|.||...:|||||.|.||..| :.|.|.
Mouse   116 VAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVP-IRHSRN 179

  Fly   130 GVKMGPGTMVD-----------SMIH-----------DGLTDAMENIHMGITAENLADKYNISRE 172
            ..||    |:|           |::.           ..:.:...|..||.:|:.||..:.:||.
Mouse   180 MRKM----MLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRM 240

  Fly   173 AQDAYAVLSQNRAEEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KE 236
            .||.||:.|.:.|::||.:|:. .:|||.::   .|..|.:||..|:. |::|.:.||:.|| |.
Mouse   241 EQDEYALRSHSLAKKAQDEGHL-SDIVPFKV---PGKDTVTKDNGIRP-SSLEQMAKLKPAFIKP 300

  Fly   237 GGSITAGNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPK-VMGLGPVTAVEALLQ 300
            .|::||.|:|.:.|.|:|:|:||.:.....|.||.|.:..:.....:|| .:.|||..|...:|:
Mouse   301 YGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLE 365

  Fly   301 KINWKREEVDLYELNEAFAAQSLAVLQDLQLD-----------------AQKVNVNGGAIALGHP 348
            |......::|.:|.:|||:.|.||..:.:..|                 .:|.|:.||:::||||
Mouse   366 KAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGSLSLGHP 430

  Fly   349 IGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            .||:|.|:::.....|.:.||:..:.:.|..||.|.|:.||
Mouse   431 FGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 133/431 (31%)
thiolase 5..390 CDD:238383 132/427 (31%)
HadhbNP_001276727.1 thiolase 56..472 CDD:238383 132/427 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.