DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and B0303.3

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_498915.1 Gene:B0303.3 / 176216 WormBaseID:WBGene00015125 Length:448 Species:Caenorhabditis elegans


Alignment Length:428 Identity:129/428 - (30%)
Similarity:217/428 - (50%) Gaps:45/428 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVFIVSAARTPIGSFNGTLSK-LKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQN 64
            |.::.:|.|.|||. ..:||:.| |.|.||....|:.::.:..:..::::.:|.|..:...:..|
 Worm    23 MPNIVLVDAVRTPF-VVSGTVFKDLMAVDLQKEAIKALVEKTKLPYEQLDHIICGTVIQECKTSN 86

  Fly    65 PARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQ 129
            .||:|:|.||:|.::||:.:.:.|.|....:..|...:.:|:|..::|||.|.:|..| :.:.|.
 Worm    87 IAREAALLAGVPDKIPAHTVTLACISSNVAMTTGMGMLATGNANAIIAGGVELLSDVP-IRYNRN 150

  Fly   130 G----------------VKMGPGTMVDSMIHDGLTDAME---NIHMGITAENLADKYNISREAQD 175
            .                :|:| |.:|.:::...|....|   ...||.:.:.||..:|:||..||
 Worm   151 ARKAMLGMNKAKDVPSKLKIG-GQIVKNLLSPELPAVAEFSTGETMGHSGDRLAAAFNVSRREQD 214

  Fly   176 AYAVLSQNRAEEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGS 239
            .:|:.|...|.||.|.|.| .::|||.: |.|...|..:|..|:. ||:|.:..|:.|| |..|:
 Worm   215 EFAIRSHTLASEAAKNGKF-TDVVPVFL-DGKKPKTIKEDNGIRV-STLEKLSSLKPAFVKPHGT 276

  Fly   240 ITAGNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPK-VMGLGPVTAVEALLQKIN 303
            :||.|||.:.|.|:|.|:|:.|.....|.||.|.:..:.....:|| .:.|.|...:..||.|..
 Worm   277 VTAANASYLTDGASAALIMTEEYALANGYKPKAYLRDYLYVAQDPKDQLLLSPAYVIPKLLDKAG 341

  Fly   304 WKREEVDLYELNEAFAAQSLAVLQDLQLD-----------------AQKVNVNGGAIALGHPIGA 351
            ...::||::|::||||.|.||.|..:..|                 ..|:|:.||::::|||.||
 Worm   342 LTLKDVDVFEIHEAFAGQVLANLNAMDSDYFCKEQMKRSGKFGRVPMDKLNLWGGSLSIGHPFGA 406

  Fly   352 SGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            :|.|:.....:.|:...|:..:.:.|..||.|:.:.:|
 Worm   407 TGVRLATHSAHRLKEEKGQYAVIAACAAGGHGVGMLIE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 129/428 (30%)
thiolase 5..390 CDD:238383 128/424 (30%)
B0303.3NP_498915.1 thiolase 27..445 CDD:238383 128/424 (30%)
AcCoA-C-Actrans 29..444 CDD:273881 127/420 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.