DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and kat-1

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_495455.2 Gene:kat-1 / 174161 WormBaseID:WBGene00002183 Length:407 Species:Caenorhabditis elegans


Alignment Length:389 Identity:155/389 - (39%)
Similarity:234/389 - (60%) Gaps:8/389 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPARQA 69
            |||.|||||||||..:||.:.|.:|.||.|:..|.|..|:...:.||.|||...|..||.|||||
 Worm    25 FIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAPARQA 89

  Fly    70 SLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG-VKM 133
            :|.|||.:.|....:|.:|.||||.:.|..|.|::|.....:.||.||||..|  .::::| :..
 Worm    90 ALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVP--FYVQRGEIPY 152

  Fly   134 GPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKEI 198
            |...::|.::.||||||.:.:|||...|..:.:..|:|:.||.||:.|..::.:|.:.|....|:
 Worm   153 GGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEV 217

  Fly   199 VPVEIKDRKGTTTFSKD-EYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVNDSAAAVLLMSGEE 262
            |||.:|.:||.|...|| |:.|.  ..:....||..|::.|:|||.|||.:||.||||::.|.|.
 Worm   218 VPVNVKSKKGVTIVDKDEEFTKV--NFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEA 280

  Fly   263 VARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVLQ 327
            |:.:.|||||||:.:..:...|....:.|......:|::...|:.:|..:|:||||:...||.::
 Worm   281 VSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGVKQSDVAQWEVNEAFSCVPLAFIK 345

  Fly   328 DLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVERL 391
            .|.:|...||.:|||:::|||||.||||::..|::.|:  .|:.|:|::|.|||....:.:::|
 Worm   346 KLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLK--SGQIGVAAICNGGGGSSGMVIQKL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 154/387 (40%)
thiolase 5..390 CDD:238383 154/386 (40%)
kat-1NP_495455.2 thiolase 25..406 CDD:238383 154/386 (40%)
PLN02644 26..407 CDD:215347 153/386 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60894
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100472
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.