DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and Acaa2

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_569117.2 Gene:Acaa2 / 170465 RGDID:620482 Length:397 Species:Rattus norvegicus


Alignment Length:388 Identity:170/388 - (43%)
Similarity:247/388 - (63%) Gaps:2/388 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQAL-SAGQGQNPAR 67
            ||||:|.|||.|::.|.|....|:||.....:..|....|..:.::.||:|..: |:......||
  Rat     7 VFIVAAKRTPFGAYGGLLKDFTATDLTEFAARAALSAGKVPPETIDSVIVGNVMQSSSDAAYLAR 71

  Fly    68 QASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPH-VMHLRQGV 131
            ...|:.|:|.:..|..:|.|||||.:::..|.|.|.|.||::|:.||.||||.:|: |.::|.|.
  Rat    72 HVGLRVGVPTETGALTLNRLCGSGFQSIVSGCQEICSKDAEVVLCGGTESMSQSPYSVRNVRFGT 136

  Fly   132 KMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDK 196
            |.|....::..:..||||....:.||:||||||.|||||||..|.||:.||.|.:.|.:.|||::
  Rat   137 KFGLDLKLEDTLWAGLTDQHVKLPMGMTAENLAAKYNISREDCDRYALQSQQRWKAANEAGYFNE 201

  Fly   197 EIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVNDSAAAVLLMSGE 261
            |:.|:|:|.:||..|...||:.:..:|:|.:|||...||:.|::|||||||::|.|..|::.|.:
  Rat   202 EMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKEGTVTAGNASGMSDGAGVVIIASED 266

  Fly   262 EVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVL 326
            .|.:....||||:||:..||.:|.:||:|||.|:...|:|.....:::||.::|||||.|.|||.
  Rat   267 AVKKHNFTPLARVVGYFVSGCDPAIMGIGPVPAITGALKKAGLSLKDMDLIDVNEAFAPQFLAVQ 331

  Fly   327 QDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            :.|.||..|.||:|||||||||:|.||:|:...|::.|.|.||:..:.|.|||||.||:|.::
  Rat   332 KSLDLDPSKTNVSGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGISLIIQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 170/388 (44%)
thiolase 5..390 CDD:238383 169/387 (44%)
Acaa2NP_569117.2 thiolase 8..395 CDD:238383 169/387 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.