DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and Acaa1a

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_570934.1 Gene:Acaa1a / 113868 MGIID:2148491 Length:424 Species:Mus musculus


Alignment Length:401 Identity:165/401 - (41%)
Similarity:235/401 - (58%) Gaps:29/401 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDVFIVSAARTPIG-SFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            |||.:|...||||| :..|........:|.|.|:..||:...::.:::.::.:|..|..|.|...
Mouse    36 SDVVVVHGRRTPIGRASRGGFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGAGAVM 100

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            ||.|...:|:|..||...:|..|.|||:.||.....||:|...|.:|.|.|||||:         
Mouse   101 ARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLS--------- 156

  Fly   131 VKMG-PGTMVDSMI-----HDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQ 189
             .|| ||.:...::     .|.||.      ||:|:||:|:::.|||:.||.:|:.||.:|..||
Mouse   157 -GMGNPGNISSRLLESEKARDCLTP------MGMTSENVAERFGISRQKQDDFALASQQKAASAQ 214

  Fly   190 KKGYFDKEIVPV--EIKDRKG---TTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVN 249
            .:|.|..|||||  .:.|.||   |.|.|:||.::..:|::|:.||:.|||:|||.||||:|.|:
Mouse   215 SRGCFRAEIVPVTTTVLDDKGDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVS 279

  Fly   250 DSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYEL 314
            |.||||||....:....||..|..:..:...|:.|.|||:||..|:.|.|||......::|::|:
Mouse   280 DGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEI 344

  Fly   315 NEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRK-GIASLCI 378
            |||||:|::..::.|.:.|:|||..|||||||||:|.:|||.:||||..|:|.|.|. |:.|:||
Mouse   345 NEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCI 409

  Fly   379 GGGMGIALAVE 389
            |.|||.|...|
Mouse   410 GTGMGAAAVFE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 165/401 (41%)
thiolase 5..390 CDD:238383 162/398 (41%)
Acaa1aNP_570934.1 PLN02287 1..420 CDD:215161 164/399 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.