DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and ACAA2

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_006102.2 Gene:ACAA2 / 10449 HGNCID:83 Length:397 Species:Homo sapiens


Alignment Length:388 Identity:173/388 - (44%)
Similarity:243/388 - (62%) Gaps:2/388 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQAL-SAGQGQNPAR 67
            ||:|:|.|||.|::.|.|....|:||.....:..|....|..:.|:.||:|..| |:......||
Human     7 VFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLAR 71

  Fly    68 QASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPH-VMHLRQGV 131
            ...|:.|:|.:.||..||.|||||.:::..|.|.|...:|::|:.||.||||.||: |.::|.|.
Human    72 HVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGT 136

  Fly   132 KMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDK 196
            |:|....::..:...|||....:.|.:||||||.|:.||||..|.||:.||.|.:.|...|||:.
Human   137 KLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFND 201

  Fly   197 EIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVNDSAAAVLLMSGE 261
            |:.|:|:|.:||..|...||:.:..:|:|.:|||...||:.|::||||||||.|.|.||::.|.:
Human   202 EMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASED 266

  Fly   262 EVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVL 326
            .|.:....|||||||:..||.:|.:||:|||.|:...|:|.....:::||.|:|||||.|.|||.
Human   267 AVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVE 331

  Fly   327 QDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            :.|.||..|.||||||||||||:|.||:|:...|::.|.|.||:..:.|.|||||.|||:.::
Human   332 RSLDLDISKTNVNGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 173/388 (45%)
thiolase 5..390 CDD:238383 172/387 (44%)
ACAA2NP_006102.2 thiolase 8..394 CDD:238383 172/385 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.