DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and RHOBTB1

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001229288.1 Gene:RHOBTB1 / 9886 HGNCID:18738 Length:696 Species:Homo sapiens


Alignment Length:230 Identity:84/230 - (36%)
Similarity:119/230 - (51%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...|....:|      :|||:  |.|        .:..:||..
Human    12 VETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDEV 76

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
            .::|.||||.|  |:.:.|..:|.::||.::|||:.||.|..:|::.||||::|.||.||:||||
Human    77 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVG 139

  Fly   115 TKLDLR-DDKNTIEKLRDKKLAPITY------PQGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
            .:|||| .|...:.:.|.....||..      .:|..:|||:| :.|.|.|...|.|:|.|||.|
Human   140 CQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELG-LPYYETSVFDQFGIKDVFDNA 203

  Fly   173 IRSVL----------------------CPVLQPKS 185
            ||:.|                      .|.|.||:
Human   204 IRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 79/195 (41%)
RHOBTB1NP_001229288.1 Rho-like 1..210 80/200 (40%)
RhoBTB 13..207 CDD:133275 79/196 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..348
BTB <396..455 CDD:197585
BTB 476..581 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.