Sequence 1: | NP_001261247.1 | Gene: | Rac1 / 38146 | FlyBaseID: | FBgn0010333 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229288.1 | Gene: | RHOBTB1 / 9886 | HGNCID: | 18738 | Length: | 696 | Species: | Homo sapiens |
Alignment Length: | 230 | Identity: | 84/230 - (36%) |
---|---|---|---|
Similarity: | 119/230 - (51%) | Gaps: | 48/230 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
Fly 50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
Fly 115 TKLDLR-DDKNTIEKLRDKKLAPITY------PQGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
Fly 173 IRSVL----------------------CPVLQPKS 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rac1 | NP_001261247.1 | Rac1_like | 3..176 | CDD:206663 | 79/195 (41%) |
RHOBTB1 | NP_001229288.1 | Rho-like | 1..210 | 80/200 (40%) | |
RhoBTB | 13..207 | CDD:133275 | 79/196 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 327..348 | ||||
BTB | <396..455 | CDD:197585 | |||
BTB | 476..581 | CDD:306997 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |