DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and RHO3

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_012148.1 Gene:RHO3 / 854688 SGDID:S000001380 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:89/214 - (41%)
Similarity:121/214 - (56%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRP 69
            |.|::||||.|||.||..:|...||..|.||||:||..::.||:|.|.|.||||||||::||||.
Yeast    18 KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRS 82

  Fly    70 LSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKL 134
            |||..|...::|||:.:..|.|||:.||..|:..||....::||..|.|||:::|....:....:
Yeast    83 LSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNI 147

  Fly   135 AP---------------------ITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLC 178
            ..                     |:|.:||||||:|||::||||||...||:...|.||.|..|.
Yeast   148 QQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVALT 212

  Fly   179 --PV---LQPKSKRKCALL 192
              ||   ::..|...|.::
Yeast   213 AGPVATEVKSDSGSSCTIM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 84/191 (44%)
RHO3NP_012148.1 Rho3 17..231 CDD:206706 89/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.