DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and RHO4

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:85/176 - (48%)
Similarity:117/176 - (66%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM-VDAKPINLGLWDTAGQEDYDRL 67
            :|.|||||||||||||||||....||.:||||:|:||..|:. .:.:.|.|.||||||||:|.||
Yeast    73 LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRL 137

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK 132
            |||||...||.::|:|:.:..|.:||...|:|||:|.||||||:|||.|.||.:..|        
Yeast   138 RPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEADN-------- 194

  Fly   133 KLAPITYPQGL-AMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177
             |:.:..|... ::||.:||..:::|||..::.:..||:.||.::|
Yeast   195 -LSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 84/173 (49%)
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 85/176 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.