DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and CDC42

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_013330.1 Gene:CDC42 / 850930 SGDID:S000004219 Length:191 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:131/192 - (68%)
Similarity:159/192 - (82%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            ||.:||||||||||||||||||||||.||.:|:|||||||:..||:..:|..|||:|||||||||
Yeast     1 MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130
            ||||||||.|||||:|||:::|.|||||:.||:|||.||||..|.::|||::||||||..||||:
Yeast    66 RLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQ 130

  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL 192
            .::|.|||..||..:|:|:.||||:|||||||:|||.||||||.:.|.|.:..||| |||:|
Yeast   131 RQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSK-KCAIL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 120/172 (70%)
CDC42NP_013330.1 Cdc42 3..177 CDD:206664 120/173 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.