DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and ROP10

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_566897.1 Gene:ROP10 / 823959 AraportID:AT3G48040 Length:208 Species:Arabidopsis thaliana


Alignment Length:185 Identity:107/185 - (57%)
Similarity:140/185 - (75%) Gaps:2/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            ||||.||||||||||:||.||:|.||.:||||||||:|.||:|:...:|||||||||||||:|||
plant     9 IKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGLWDTAGQEDYNRLR 73

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            ||||...|||::.|||::.||:|||..||.||::|..|..||:|||||:|||:|::.:..  ...
plant    74 PLSYRGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDRHYLSD--HPG 136

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK 188
            |:|:|..||..:.|.|||..|:|||:.||:.:|.|||.||:.|:.|.::.|.|:|
plant   137 LSPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAAIKVVIKPAVKQKEKKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 102/171 (60%)
ROP10NP_566897.1 Rop_like 8..180 CDD:206705 102/172 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 1 0.900 - - OOG6_100633
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.