DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and ARAC1

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001077910.1 Gene:ARAC1 / 816290 AraportID:AT2G17800 Length:197 Species:Arabidopsis thaliana


Alignment Length:193 Identity:117/193 - (60%)
Similarity:142/193 - (73%) Gaps:6/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            ||||.||||||||||||||||:|.||.:|:||||||:||||:|:...:|||||||||||||:|||
plant     7 IKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLR 71

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            ||||...|||::.|||::.||:|||..||.||::|:.|..||:||||||||||||...  :....
plant    72 PLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFF--IDHPG 134

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK----CALL 192
            ..|||..||..:.|.|||..|:|||:.||:.:|.|||.|||.||.|..|.|.|.|    |::|
plant   135 AVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQPPKQKKKKSKAQKACSIL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 108/171 (63%)
ARAC1NP_001077910.1 Rop_like 6..178 CDD:206705 108/172 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 231 1.000 Domainoid score I651
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69035
Inparanoid 1 1.050 237 1.000 Inparanoid score I1099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 1 1.000 - - mtm1108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.