DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rnd3a

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_955816.1 Gene:rnd3a / 80963 ZFINID:ZDB-GENE-010319-40 Length:243 Species:Danio rerio


Alignment Length:174 Identity:78/174 - (44%)
Similarity:115/174 - (66%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QAIKC--VVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDY 64
            |::||  |||||...|||.||..:..:.||..|:||||:||:|:..:|.:.|.|.||||:|...|
Zfish    20 QSLKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDKQRIELSLWDTSGSPYY 84

  Fly    65 DRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKL 129
            |.:||||||.:|..:|||.:..|.:.::|..||..|::..||:|.::|||.|.|||.|..|:.:|
Zfish    85 DNVRPLSYPDSDAVIICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDLTTLVEL 149

  Fly   130 RDKKLAPITYPQGLAMAKEIGAVKYLECSAL-TQKGLKTVFDEA 172
            .:.:..|::|.||.||||:|.| .|:||||: ::..::.:|..|
Zfish   150 SNHRQTPVSYDQGSAMAKQISA-PYIECSAVQSENSVRDIFHVA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 77/173 (45%)
rnd3aNP_955816.1 Rnd3_RhoE_Rho8 19..197 CDD:206735 78/174 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.