DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and Rhoj

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_075764.1 Gene:Rhoj / 80837 MGIID:1931551 Length:214 Species:Mus musculus


Alignment Length:197 Identity:116/197 - (58%)
Similarity:145/197 - (73%) Gaps:12/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :||||||||||||||||:||..:|||.||:|||||:|:..|.|..|...|||:||||||||::||
Mouse    22 LKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLR 86

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            |||||.|||||||||:|||||:.||:.:|.||::...|..|.:|:||::|||||..|:.:|...|
Mouse    87 PLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMK 151

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK--------CA 190
            ..|:||..|:.:||.|||..|||||||||||||.||||||.:    :..||.|:|        ||
Mouse   152 EKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILT----IFHPKKKKKGCLGCHGCCA 212

  Fly   191 LL 192
            ::
Mouse   213 II 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 110/171 (64%)
RhojNP_075764.1 P-loop_NTPase 22..195 CDD:304359 110/176 (63%)
RHO 24..197 CDD:197554 109/176 (62%)
Effector region. /evidence=ECO:0000255 50..58 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.