DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rac1l

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_001332092.1 Gene:rac1l / 792699 ZFINID:ZDB-GENE-060315-6 Length:192 Species:Danio rerio


Alignment Length:191 Identity:128/191 - (67%)
Similarity:150/191 - (78%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            ||.:|||:|||.||.||.||.||||......|:|||||..|.:::||..|:.||||||||||||.
Zfish     1 MQNVKCVLVGDAAVEKTALLFSYTTGKCQDGYVPTVFDKLSVDLVVDGNPVALGLWDTAGQEDYT 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130
            .|||||||.|||||:|||.|.|.|||||..||.||||||||:|||:||||||||::||.|||.|:
Zfish    66 ILRPLSYPNTDVFLVCFSCVGPQSFENVSEKWLPEVRHHCPNTPIVLVGTKLDLKNDKETIEHLK 130

  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCAL 191
            :||..||::.:|||.|:||||||||||||.|.||:|||||||||:||.|..:...||||.:
Zfish   131 EKKQTPISFHRGLAKAEEIGAVKYLECSAKTLKGVKTVFDEAIRAVLNPQEENIRKRKCLI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 119/172 (69%)
rac1lXP_001332092.1 P-loop_NTPase 3..176 CDD:304359 119/172 (69%)
RHO 6..179 CDD:197554 120/172 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.