Sequence 1: | NP_001261247.1 | Gene: | Rac1 / 38146 | FlyBaseID: | FBgn0010333 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082769.1 | Gene: | Rhobtb3 / 73296 | MGIID: | 1920546 | Length: | 611 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 46/199 - (23%) |
---|---|---|---|
Similarity: | 80/199 - (40%) | Gaps: | 43/199 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 VVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPI--NLGLWDTAGQEDYDRLRP 69
Fly 70 LSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIIL--VGTKLDLRDDKNTIEKLRDK 132
Fly 133 KLAPITYP-------------QGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPK 184
Fly 185 SKRK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rac1 | NP_001261247.1 | Rac1_like | 3..176 | CDD:206663 | 43/185 (23%) |
Rhobtb3 | NP_082769.1 | Rho-like | 1..175 | 40/166 (24%) | |
P-loop_NTPase | 34..174 | CDD:304359 | 39/165 (24%) | ||
BTB | 413..515 | CDD:279045 | |||
Interaction with Rab9. /evidence=ECO:0000250 | 420..611 | ||||
BTB | 421..518 | CDD:197585 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24072 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |