DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhof

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001018478.1 Gene:rhof / 573655 ZFINID:ZDB-GENE-050522-280 Length:209 Species:Danio rerio


Alignment Length:194 Identity:94/194 - (48%)
Similarity:120/194 - (61%) Gaps:4/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67
            |:|.|:||||..|||.||:.|....||.:|.|:|||.|...|....|.|.|.|:|||||||||||
Zfish    16 ALKIVIVGDGGCGKTSLLMVYAKGDFPEKYAPSVFDKYVTTVSYGGKDIQLNLYDTAGQEDYDRL 80

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK 132
            |||||...::.|||:.:.||.||:||:.||||||||.|...||||:..|.|||.||..:.:|:..
Zfish    81 RPLSYQDVNIVLICYDVTNPTSFDNVKIKWYPEVRHFCRDAPIILISCKTDLRKDKEKMRRLKAL 145

  Fly   133 KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVL----QPKSKRKCALL 192
            ..|||||..|....||:.|..||||||..::.::.:|.||.:..|....    :.|.|:.|.:|
Zfish   146 DQAPITYLLGEQTQKEMNAEIYLECSAKYRENVEDIFREATKRALAARAKARHRSKKKKHCTVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 89/172 (52%)
rhofNP_001018478.1 P-loop_NTPase 17..209 CDD:304359 92/191 (48%)
RHO 19..186 CDD:197554 86/166 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.