DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhobtb2b

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_017213602.2 Gene:rhobtb2b / 565844 ZFINID:ZDB-GENE-071125-1 Length:722 Species:Danio rerio


Alignment Length:229 Identity:84/229 - (36%)
Similarity:117/229 - (51%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...||...:|      :|||:  |.|        .:..:||..
Zfish    23 VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDV 87

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
            .::|.||||.|  |:.:.|..:|.::||.::|||:.||.|..:|:..||||::|.||..|:||||
Zfish    88 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLFHVKTMWYPEIKHFCPRAPVILVG 150

  Fly   115 TKLDLR-DDKNTIEKLRDKKLAPITY------PQGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
            .:|||| .|...:.:.|.....||..      .:|..:|||: .|.|.|.|.:.|.|:|.|||.|
Zfish   151 CQLDLRYADLEAVNRARRPLARPIKANEILPPEKGREVAKEL-CVPYYETSVVAQFGVKDVFDNA 214

  Fly   173 IRSVL----------------------CPVLQPK 184
            ||:.|                      .|.|.||
Zfish   215 IRAALISRRHLQFWKSHLRDVQRPLLQAPFLPPK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 79/195 (41%)
rhobtb2bXP_017213602.2 RhoBTB 24..218 CDD:133275 79/196 (40%)
BTB 270..>310 CDD:321966
BTB <412..456 CDD:333434
BTB 487..579 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.