DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhoj

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001038266.1 Gene:rhoj / 556371 ZFINID:ZDB-GENE-040724-272 Length:226 Species:Danio rerio


Alignment Length:187 Identity:122/187 - (65%)
Similarity:146/187 - (78%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :||||||||||||||||:||..:|||.||||||||:|:.||.|..:...|||:||||||||::||
Zfish    34 LKCVVVGDGAVGKTCLLMSYANDAFPEEYIPTVFDHYAVNVTVSGRQHLLGLYDTAGQEDYNQLR 98

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            |||||.|||||||||:|||||:.||:.:|.||:|...|..|.||:||::|||||..|:.:|...|
Zfish    99 PLSYPNTDVFLICFSVVNPASYHNVQEEWVPELRSCMPHVPYILIGTQIDLRDDPKTLARLLQMK 163

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCA 190
            ..|:||.|||.:|:||||..||||||||||||||||||||.::..|   .|.||.||
Zfish   164 EKPLTYEQGLKLAREIGAQCYLECSALTQKGLKTVFDEAILTIFSP---KKQKRGCA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 116/171 (68%)
rhojNP_001038266.1 P-loop_NTPase 34..207 CDD:304359 116/172 (67%)
RHO 36..209 CDD:197554 115/172 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.