DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and cdc42l2

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_021325487.1 Gene:cdc42l2 / 556226 ZFINID:ZDB-GENE-060312-21 Length:209 Species:Danio rerio


Alignment Length:194 Identity:105/194 - (54%)
Similarity:134/194 - (69%) Gaps:13/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            |..||||||||.||||||||:|: ||.||.|  ||||:..|..||:..:|..:.|::.|||   |
Zfish    25 MSTIKCVVVGDEAVGKTCLLVSF-TNKFPSE--PTVFNTQSVTVMMGGEPYTIRLFNAAGQ---D 83

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130
            :||||:||||||||:|||:|:.:|||||:.||.||:..:.|.||.:||||::|||||..|:.:|.
Zfish    84 QLRPLNYPQTDVFLVCFSVVSLSSFENVKEKWVPEITFYAPKTPFLLVGTQIDLRDDPVTVARLA 148

  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKR---KCAL 191
            ..|..||.......:|:|:.||||:||||||.||||.||||||.:    .|||...:   ||.:
Zfish   149 KNKQKPIKPEAAEKLARELKAVKYVECSALTLKGLKNVFDEAILA----ALQPSGSQNTCKCVI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 99/172 (58%)
cdc42l2XP_021325487.1 P-loop_NTPase 27..195 CDD:328724 99/177 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.