DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhobtb4

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001352487.1 Gene:rhobtb4 / 553415 ZFINID:ZDB-GENE-060315-11 Length:729 Species:Danio rerio


Alignment Length:232 Identity:89/232 - (38%)
Similarity:122/232 - (52%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...||...:|      :|||:  |.|        .:..:||..
Zfish    25 VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDEV 89

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
            .::|.||||.|  |:.:.|..:|.::||.::||||.||.|..:||..|:||::|.||.|||||||
Zfish    90 SVSLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSLANPNSLRHVRTMWFPEIKHFCPRTPIILVG 152

  Fly   115 TKLDLR-DDKNTIEKLRDKKLAPI----TYP--QGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
            .:|||| .|.:.:.:.|.....||    ..|  :|..:|||:| |.|.|.|.:.|.|:|.|||.|
Zfish   153 CQLDLRYADLDAVNRARRPLAKPIKPTDILPPERGHEVAKELG-VPYYETSIVAQFGVKDVFDNA 216

  Fly   173 IRSVL----------------------CPVLQPKSKR 187
            ||:.|                      .|.|.|:..|
Zfish   217 IRAALISRRHLQFWKSHLKKVQRPLLQAPFLPPRPPR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 84/195 (43%)
rhobtb4NP_001352487.1 RhoBTB 26..220 CDD:133275 84/196 (43%)
BTB <426..486 CDD:333434
BTB 505..612 CDD:306997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.