DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhoh

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001314902.1 Gene:rhoh / 553413 ZFINID:ZDB-GENE-060228-7 Length:195 Species:Danio rerio


Alignment Length:180 Identity:78/180 - (43%)
Similarity:117/180 - (65%) Gaps:17/180 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67
            ::|||:|||.|||||.||:.:|:..||..|.|||::|...:|.:|...|:||||||||.:.:.::
Zfish     8 SVKCVLVGDCAVGKTALLVRFTSETFPDSYRPTVYENTGVDVFMDGIQISLGLWDTAGHDTFRQI 72

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK 132
            ||:||..|||.|:|:|:.||:|..|:|.||..|||.:.|..|:::|.|:.|.|:           
Zfish    73 RPMSYQDTDVVLLCYSVANPSSLNNLRHKWIAEVREYLPKVPVLVVATQTDHRE----------- 126

  Fly   133 KLAP-----ITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177
             :.|     .|.|:|..:|:||.|..|||||||:.:|::.||:.|:|:.:
Zfish   127 -MGPYRANCTTSPEGKQVAQEIRAKGYLECSALSNRGVQQVFECAVRTAV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 78/177 (44%)
rhohNP_001314902.1 Rho 9..173 CDD:206641 77/175 (44%)
RHO 11..176 CDD:197554 77/177 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.