DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhou

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001016852.1 Gene:rhou / 548469 XenbaseID:XB-GENE-491190 Length:243 Species:Xenopus tropicalis


Alignment Length:188 Identity:98/188 - (52%)
Similarity:137/188 - (72%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :|||::||||||||.||:|||||.:|..||||.||::||.|.|:..|:.|.|.|||||:::|:||
 Frog    36 LKCVLLGDGAVGKTSLLVSYTTNGYPTRYIPTAFDDFSALVQVENTPVKLQLCDTAGQDEFDKLR 100

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            ...||:|||.::|||:|:|:||:|:..||..|::.|||..|::||||:.|||:|...:.:|...:
 Frog   101 HFCYPRTDVLILCFSVVSPSSFQNISEKWISEIQCHCPHVPVVLVGTQCDLREDVKVLIQLARYQ 165

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL-CPVLQPKSKRKCA 190
            ..|::.....|:|::||||.|:||||||||.||.|||.||.|.| ...|:.:.:||.|
 Frog   166 EKPVSNSSARALAEKIGAVAYVECSALTQKNLKEVFDTAIISGLRYSDLRGQRERKMA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 92/171 (54%)
rhouNP_001016852.1 Wrch_1 36..208 CDD:133330 92/171 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.