Sequence 1: | NP_001261247.1 | Gene: | Rac1 / 38146 | FlyBaseID: | FBgn0010333 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998515.1 | Gene: | rhoac / 406659 | ZFINID: | ZDB-GENE-040426-2665 | Length: | 193 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 107/197 - (54%) |
---|---|---|---|
Similarity: | 136/197 - (69%) | Gaps: | 9/197 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQAI--KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQED 63
Fly 64 YDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEK 128
Fly 129 LRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK---CA 190
Fly 191 LL 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rac1 | NP_001261247.1 | Rac1_like | 3..176 | CDD:206663 | 100/174 (57%) |
rhoac | NP_998515.1 | RhoA_like | 5..179 | CDD:206662 | 98/177 (55%) |
RHO | 8..181 | CDD:197554 | 98/176 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |