DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rnd1a

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_998019.3 Gene:rnd1a / 405780 ZFINID:ZDB-GENE-040630-6 Length:232 Species:Danio rerio


Alignment Length:190 Identity:80/190 - (42%)
Similarity:116/190 - (61%) Gaps:9/190 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRP 69
            |.|:|||...|||.:|.....:.:|..|:||||:||:|.:.::.:.:.|.||||:|...||.:||
Zfish    15 KLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTAGLELEEQRVELSLWDTSGSPYYDNVRP 79

  Fly    70 LSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKL 134
            |.|...|..|:||.:..|.:.|:...||..|:...||||.|||||.|.|||.|..|:.:|.:::|
Zfish    80 LCYSDADAVLLCFDISRPDTVESSLKKWKAEIMDFCPSTRIILVGCKTDLRTDVCTLMELSNQRL 144

  Fly   135 APITYPQGLAMAKEIGAVKYLECSALT-QKGLKTVFDEAIRSVLC------PVLQPKSKR 187
            .||::.||..:||::||..||||||.| :|.:.:||..|  |:.|      |:.|..::|
Zfish   145 TPISHEQGTLLAKQVGAEVYLECSAFTSEKSIHSVFRSA--SLTCLNKLQPPIKQSPTRR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 75/171 (44%)
rnd1aNP_998019.3 P-loop_NTPase 1..232 CDD:304359 80/190 (42%)
RHO 16..190 CDD:197554 76/175 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.