DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and RhoBTB

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster


Alignment Length:203 Identity:78/203 - (38%)
Similarity:110/203 - (54%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QAIKCVVVGDGAVGKTCLLISYTTN------AFPGEYIPTVF--DNYS--ANVM------VDAKP 50
            :.:|||:|||.|||||.|:.:...|      .....::|||:  |.|.  .:|:      ||...
  Fly    12 ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVN 76

  Fly    51 INLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGT 115
            ::|.||||.|  |:|:.|..:|.::||.|:|||:.:|.|..|.:..||||:|..||..|:||||.
  Fly    77 VSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGC 139

  Fly   116 KLDLR---DDKNTIEKLRDK--------KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVF 169
            |.|||   .|:|.:....:|        |...:...:..|:|||:| |.|.|.|..|..|:..||
  Fly   140 KNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELG-VAYYETSVFTYFGVNEVF 203

  Fly   170 DEAIRSVL 177
            :.||||.|
  Fly   204 ENAIRSAL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 76/199 (38%)
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 76/200 (38%)
RHO 16..211 CDD:197554 76/197 (39%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.