DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhoq

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_956112.1 Gene:rhoq / 327510 ZFINID:ZDB-GENE-030131-5721 Length:205 Species:Danio rerio


Alignment Length:195 Identity:123/195 - (63%)
Similarity:148/195 - (75%) Gaps:6/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :||||||||||||||||:||..:|||.||:|||||:|:.:|.|..|...|||:||||||||||||
Zfish    10 LKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLR 74

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKK 133
            |||||.|||||||||:||||||:|||.:|.||::.:.|:.|.:|:||::|||||..||.||.|.|
Zfish    75 PLSYPMTDVFLICFSVVNPASFQNVREEWVPELQEYAPNIPYLLIGTQIDLRDDPKTIAKLNDVK 139

  Fly   134 LAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKR------KCALL 192
            ..||...||..:||||||..|:||||||||||||||||||.::|.|......:|      .|.|:
Zfish   140 EKPIVTEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILAPKKGALKRRLGPRCINCCLI 204

  Fly   193  192
            Zfish   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 118/171 (69%)
rhoqNP_956112.1 P-loop_NTPase 10..183 CDD:304359 118/172 (69%)
RHO 12..185 CDD:197554 118/172 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.