DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and Rhobtb1

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001101092.1 Gene:Rhobtb1 / 309722 RGDID:1306871 Length:695 Species:Rattus norvegicus


Alignment Length:230 Identity:83/230 - (36%)
Similarity:117/230 - (50%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
            ::.||||||||.|||||.|:.:...|....:|      :|||:  |.|        .:..:||..
  Rat    12 VETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDEV 76

  Fly    50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
            .|:|.||||.|  |:.:.|..:|.::||.::|||:.||.|..:|:..||.|::|.||.||::|||
  Rat    77 SISLRLWDTFG--DHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVG 139

  Fly   115 TKLDLR-DDKNTIEKLRDKKLAPITY------PQGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
            .:|||| .|...:.:.|.....||..      .:|..:|||:| :.|.|.|...|.|:|.|||.|
  Rat   140 CQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELG-IPYYETSVFDQFGIKDVFDNA 203

  Fly   173 IRSVL----------------------CPVLQPKS 185
            ||:.|                      .|.|.||:
  Rat   204 IRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 78/195 (40%)
Rhobtb1NP_001101092.1 RhoBTB 13..207 CDD:133275 78/196 (40%)
BTB_POZ 248..459 CDD:365784
BTB_POZ 464..589 CDD:365784
BACK_RHOBTB1 592..691 CDD:350605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.