Sequence 1: | NP_001261247.1 | Gene: | Rac1 / 38146 | FlyBaseID: | FBgn0010333 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036014493.1 | Gene: | Rhobtb2 / 246710 | MGIID: | 2180557 | Length: | 750 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 85/229 - (37%) |
---|---|---|---|
Similarity: | 119/229 - (51%) | Gaps: | 48/229 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEY------IPTVF--DNY--------SANVMVDAK 49
Fly 50 PINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVG 114
Fly 115 TKLDLR-DDKNTIEKLRDKKLAPI----TYP--QGLAMAKEIGAVKYLECSALTQKGLKTVFDEA 172
Fly 173 IRSVL----------------------CPVLQPK 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rac1 | NP_001261247.1 | Rac1_like | 3..176 | CDD:206663 | 80/195 (41%) |
Rhobtb2 | XP_036014493.1 | RhoBTB | 35..229 | CDD:133275 | 80/196 (41%) |
BTB_POZ | 272..497 | CDD:365784 | |||
BTB2_POZ_RHOBTB2 | 502..625 | CDD:349668 | |||
BACK_RHOBTB2 | 630..726 | CDD:350606 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |