DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and crp-1

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_505688.1 Gene:crp-1 / 179462 WormBaseID:WBGene00012532 Length:187 Species:Caenorhabditis elegans


Alignment Length:193 Identity:81/193 - (41%)
Similarity:119/193 - (61%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLR 68
            :|.|||||...|||.||::||...|...|..|||||::.:|.:|.|...:.|:|||||.:|:::|
 Worm     5 LKLVVVGDTYTGKTSLLVAYTKKQFLDNYTTTVFDNWAVSVHIDNKNYAVNLFDTAGQGNYEQIR 69

  Fly    69 PLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHC-PSTPIILVGTKLDLRDD---KNTIEKL 129
            .||||..:|||:|||:::..:.|:.|:.|.||:|.:. .:.||:|||||.||.||   :||:.:.
 Worm    70 CLSYPHANVFLVCFSMIDRKTLESCRSTWIPEIRKYAGDNVPIMLVGTKNDLVDDADSRNTVTED 134

  Fly   130 RDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL 192
            ..|:           :|.|||..|:..|||||.||||.||||:..:.:...|:.::...|..:
 Worm   135 YAKR-----------VAHEIGCHKFYSCSALTHKGLKRVFDESFLAAVGVKLEEETPNPCCTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 79/175 (45%)
crp-1NP_505688.1 Rho 5..169 CDD:206641 79/174 (45%)
RHO 7..171 CDD:197554 78/174 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.