DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and Rac3

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_573486.1 Gene:Rac3 / 170758 MGIID:2180784 Length:192 Species:Mus musculus


Alignment Length:191 Identity:171/191 - (89%)
Similarity:182/191 - (95%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||.||:||||||||||||||
Mouse     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130
            ||||||||||||||||||||:||||||||||||||||||||.|||:||||||||||||:|||:||
Mouse    66 RLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLR 130

  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCAL 191
            ||||||||||||||||:|||:|||||||||||:|||||||||||:||||....|..:||.:
Mouse   131 DKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 162/172 (94%)
Rac3NP_573486.1 Rac1_like 3..176 CDD:206663 162/172 (94%)
Effector region. /evidence=ECO:0000255 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 342 1.000 Domainoid score I1070
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100633
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.