DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and LOC100537765

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_021326673.1 Gene:LOC100537765 / 100537765 -ID:- Length:157 Species:Danio rerio


Alignment Length:157 Identity:131/157 - (83%)
Similarity:140/157 - (89%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MVDAKPINLGLWDTAGQEDYDRLRPLSYPQT---------DVFLICFSLVNPASFENVRAKWYPE 100
            |||.||:||||||||||||||||||||||||         ||||||||||:||||||||||||||
Zfish     1 MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTFNVNAFLSQDVFLICFSLVSPASFENVRAKWYPE 65

  Fly   101 VRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGL 165
            |||||.:||||||||||||||||:|||||::|||.|||||||||||||||||||||||||||:||
Zfish    66 VRHHCQTTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGL 130

  Fly   166 KTVFDEAIRSVLCPVLQPKSKRKCALL 192
            |||||||||:||||....|.||||:||
Zfish   131 KTVFDEAIRAVLCPPPVKKRKRKCSLL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 120/139 (86%)
LOC100537765XP_021326673.1 P-loop_NTPase <1..141 CDD:328724 120/139 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.