DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac1 and rhov

DIOPT Version :9

Sequence 1:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001012250.1 Gene:rhov / 100005849 ZFINID:ZDB-GENE-031002-10 Length:235 Species:Danio rerio


Alignment Length:186 Identity:93/186 - (50%)
Similarity:127/186 - (68%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67
            ||.|::|||||||||.:::|||||.:|.:|..|.||.:|..|.||..|:.:.|.||||||::|..
Zfish    29 AISCMLVGDGAVGKTSMIVSYTTNGYPTDYKQTAFDVFSGQVQVDGTPVRIQLMDTAGQEEFDEF 93

  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK 132
            |.|||..|||||:|||:|||.||:|:..||.||:|...||:|||||||:.||..|.|.:..|...
Zfish    94 RSLSYAHTDVFLLCFSVVNPTSFQNITKKWIPEIRECNPSSPIILVGTQSDLVLDVNVLIDLDRY 158

  Fly   133 KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK 188
            |:.|:...:..:::::|.|.:|:||||||||.||..||.||.:.:....:...||:
Zfish   159 KVKPVCSSRARSLSEKIRAAEYVECSALTQKNLKEAFDAAIFAAIKHKARKAKKRR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 91/172 (53%)
rhovNP_001012250.1 Wrch_1 30..193 CDD:133330 85/162 (52%)
RHO 32..193 CDD:197554 84/160 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.