DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and RCN2

DIOPT Version :9

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001258766.1 Gene:RCN2 / 5955 HGNCID:9935 Length:335 Species:Homo sapiens


Alignment Length:346 Identity:115/346 - (33%)
Similarity:193/346 - (55%) Gaps:41/346 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTRIQMLLLVVALTAVISGASASSIPEELPHNPLEHDPLHPRHFDGGEHNAQFDHEAFLGPDES- 66
            ||....|||   |.|..:||..:   ||| |.||            ||..:.:|.||.||..|. 
Human     6 RTAALGLLL---LCAAAAGAGKA---EEL-HYPL------------GERRSDYDREALLGVQEDV 51

  Fly    67 KKFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQHNPDNNET 131
            .::..|..||.::||..|:.:||.:.||.:|.:||.:||..:.:.|..::..:.:.:::.::::|
Human    52 DEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDT 116

  Fly   132 ISWDSYMQTVY----GFMDDLSPDEKEQE----ENGVSYKS-----LLK-----RDRYRWSVADQ 178
            ::||.|...:|    .|.::.:.|:.|:|    |..:..|.     ||:     :|:.|:..|:|
Human   117 VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFNLHLKDKKRFEKANQ 181

  Fly   179 DLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEW 243
            |....|:.:||.||.|||:...|...|::|.:.:.||:.||.:|::|::|| ||.....:|:|||
Human   182 DSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGD-YRWDPTANEDPEW 245

  Fly   244 VANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKY 308
            :..|::.|....|.|.||.|:.:|:..|:.|::...::.||.||:.|.|.:.|.||::||||:..
Human   246 ILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENP 310

  Fly   309 DVFVGSQATDFGEALARHDEF 329
            |:|:.|:|||:|..|  ||::
Human   311 DLFLTSEATDYGRQL--HDDY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 21/56 (38%)
EFh 206..273 CDD:238008 24/66 (36%)
EF-hand_7 248..308 CDD:290234 22/59 (37%)
EFh 248..306 CDD:298682 21/57 (37%)
RCN2NP_001258766.1 EFh_CREC_RCN2 29..314 CDD:320022 94/297 (32%)
EF-hand motif 29..59 CDD:320022 12/41 (29%)
EF-hand motif 65..94 CDD:320022 12/28 (43%)
EF-hand motif 101..130 CDD:320022 5/28 (18%)
EF-hand motif 171..200 CDD:320022 12/28 (43%)
EF-hand motif 208..237 CDD:320022 12/29 (41%)
EF-hand motif 249..278 CDD:320022 10/28 (36%)
EF-hand motif 285..314 CDD:320022 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.