DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and RCN3

DIOPT Version :9

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_024307388.1 Gene:RCN3 / 57333 HGNCID:21145 Length:365 Species:Homo sapiens


Alignment Length:376 Identity:148/376 - (39%)
Similarity:205/376 - (54%) Gaps:62/376 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTRIQMLLLVVALTAVISGASASSIPEELPHN--------PLEHDPLHPRHFDGGEHNAQFDH 57
            |.|..:.:|||::.     .||.....|:..||.        ||...|     .|....|.|:||
Human     2 MWRPSVLLLLLLLR-----HGAQGKPSPDAGPHGQGRVHQAAPLSDAP-----HDDAHGNFQYDH 56

  Fly    58 EAFLGPDESKKFDSLTPEESRRRLGVIVDRIDE--NKDGSVTLAELKNWIAYTQRRYIEEDVGRV 120
            |||||.:.:|:||.||||||:.|||.||||:|.  :.||.|:||||:.|||:||:|:|.:.|...
Human    57 EAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAA 121

  Fly   121 WKQHNPDNNETISWDSYMQTVYGFMDDLSPDEKEQE-ENGVSYKSLLKRDRYRWSVADQDLDDNL 184
            |..::.|.:..:.|:......||   ..:|.|:..: |:..:||.:|.||..|:.|||||.|...
Human   122 WDTYDTDRDGRVGWEELRNATYG---HYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMA 183

  Fly   185 TKDEFTAFLHPEDHPSMKGVV-------------------------------------LRETITD 212
            |::|.|||||||:.|.|:.:|                                     |:||:.|
Human   184 TREELTAFLHPEEFPHMRDIVIALPGAKFPREPLTLTPGVQPPPGARVIGPQPQCPFLLQETLED 248

  Fly   213 LDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDF 277
            ||::.||.:.|:|||.|:|.:...| |||.||..||:.|...|||:|||:|:..||..|:.|...
Human   249 LDRNKDGYVQVEEYIADLYSAEPGE-EEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQ 312

  Fly   278 DHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDE 328
            |....||.|||.|:|.|.|.:|:|.|||..:::|||||||::||.|.||.:
Human   313 DQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 29/93 (31%)
EFh 206..273 CDD:238008 33/66 (50%)
EF-hand_7 248..308 CDD:290234 28/59 (47%)
EFh 248..306 CDD:298682 27/57 (47%)
RCN3XP_024307388.1 EFh_CREC_RCN3 44..348 CDD:320028 125/312 (40%)
EF-hand motif 44..73 CDD:320028 15/33 (45%)
EF-hand motif 79..110 CDD:320028 18/30 (60%)
EF-hand motif 117..146 CDD:320028 6/31 (19%)
EF-hand motif 167..196 CDD:320028 17/28 (61%)
EF-hand motif 204..270 CDD:320028 15/65 (23%)
EF-hand motif 282..311 CDD:320028 14/28 (50%)
EF-hand motif 318..348 CDD:320028 15/29 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10751
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 1 1.000 - - otm40495
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1088
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.