DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and rcn2

DIOPT Version :9

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001025434.1 Gene:rcn2 / 571340 ZFINID:ZDB-GENE-050706-62 Length:322 Species:Danio rerio


Alignment Length:327 Identity:106/327 - (32%)
Similarity:164/327 - (50%) Gaps:24/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTRIQMLLLVVALTAVISGASASSIPEELPHNPLEHDPLHPRHFDGGEHNAQFDHEAFLGPDESK 67
            :.|...|||:|   |.:|||..:.......||          |    ||||    ..|||.::..
Zfish    18 KIRYTFLLLLV---AYVSGAVGNREDHVFKHN----------H----EHNA----NTFLGSEDKD 61

  Fly    68 KFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQHNPDNNETI 132
            :...|:|.|.|:||..||.:||.|.|..:|..|:..||....|:|..:|....:.:.:.:|:..:
Zfish    62 EIQKLSPSEQRKRLVEIVKKIDTNSDKYLTPEEITVWIQRVYRKYALDDAEERFPEFDSNNDGLV 126

  Fly   133 SWDSYMQTVYGFMDDLSPDEKEQEENGVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPED 197
            |||.|...::|...::..|...::....|.:.|..:::.|:..|:.|....|...||.||.||.:
Zfish   127 SWDEYNMVMHGHTVEVDADAVLEDPEEESLRFLHAKEKRRFDFANMDGSAGLNLTEFLAFTHPSE 191

  Fly   198 HPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGY 262
            ...|....:.:.:::.|.|.||.||:.|:|||:  .|..:||..:|...|...|....|.|:||.
Zfish   192 VDHMTDFAIEDVLSEYDLDKDGFISLSEFIGDL--RTNEQDEPSQWEIEETVRFKDLYDQDQDGK 254

  Fly   263 LNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEAL-ARH 326
            ||.:|..:|:||:.:..:..||.||:.|.|.|.|::|::.|||...|.|:.|:.||:|..| ..|
Zfish   255 LNRDEQLRWVAPNSYGSAREEALHLIKEMDQDGDNRLSETEILKNQDTFMHSEVTDYGRQLHVPH 319

  Fly   327 DE 328
            ||
Zfish   320 DE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 18/56 (32%)
EFh 206..273 CDD:238008 24/66 (36%)
EF-hand_7 248..308 CDD:290234 23/59 (39%)
EFh 248..306 CDD:298682 22/57 (39%)
rcn2NP_001025434.1 EFh 74..136 CDD:298682 20/61 (33%)
EF-hand_7 75..131 CDD:290234 18/55 (33%)
EF-hand_7 164..221 CDD:290234 18/56 (32%)
EFh 165..221 CDD:298682 18/55 (33%)
EFh 200..265 CDD:238008 24/66 (36%)
EF-hand_7 200..259 CDD:290234 22/60 (37%)
EF-hand_7 245..298 CDD:290234 21/52 (40%)
EFh 245..298 CDD:298682 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.