DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and Scp1

DIOPT Version :10

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001015389.1 Gene:Scp1 / 3355102 FlyBaseID:FBgn0020908 Length:189 Species:Drosophila melanogaster


Alignment Length:179 Identity:37/179 - (20%)
Similarity:58/179 - (32%) Gaps:66/179 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SWDSYMQTVYGFMDDLSPDEKEQEENGV----------------------------SYKSLLKRD 169
            |||:.:..|..:|.|:       :.||.                            .||.|:|. 
  Fly     4 SWDNRVDFVVRYMYDI-------DNNGFLDQNDFLCMAVRACVVEGKGDCSTARLDDYKKLMKN- 60

  Fly   170 RYRW----SVADQDLDDNLTKDEFTAFLHP-------EDHPSMKGVVLRETITDLDKDHDGKISV 223
              .|    ::||.|.|..::..||...:..       |:.|......:......||.|.||.:.|
  Fly    61 --LWDEISAIADDDKDGKISNQEFKDAVKKTCVGKKYEEFPQAMRAFIESNFKLLDIDSDGIVGV 123

  Fly   224 DEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDK--DGYLNEEEVKQ 270
            .||..:.......:|..|               :||  :..||:|:.|:
  Fly   124 KEYRYNCITRVAIDDITP---------------IDKAFETLLNDEDRKR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EFh_CREC_Calumenin_like 45..313 CDD:320024 37/179 (21%)
EF-hand motif 45..74 CDD:320024
EF-hand motif 80..109 CDD:320024
EF-hand motif 116..145 CDD:320024 4/11 (36%)
EF-hand motif 168..197 CDD:320024 7/39 (18%)
EF-hand motif 205..234 CDD:320024 8/28 (29%)
EF-hand motif 247..276 CDD:320024 6/26 (23%)
EF-hand motif 283..313 CDD:320024
Scp1NP_001015389.1 FRQ1 16..>127 CDD:444056 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.