DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and CG31650

DIOPT Version :9

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster


Alignment Length:333 Identity:124/333 - (37%)
Similarity:189/333 - (56%) Gaps:23/333 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IQMLLLVVALTAVIS-----GASASSIPEE--LPHNPLEHDPLHPR----HFDGGEHNAQFDHEA 59
            :.:.|..|||.|.:.     ||.|:|...|  |....::.....||    |.:.||||.:|||||
  Fly     8 LPLTLCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNVEFDHEA 72

  Fly    60 FLG-PDESKKFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQ 123
            .:| ..|:::||||:|:||:|||.:::..:|.|||..:...|||.||..:.::..||:....:::
  Fly    73 IIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEE 137

  Fly   124 HNPDNNETISWDSYMQTVYGFMDDLSPDEKEQEENGVSY---KSLLKRDRYRWSVADQDLDDNLT 185
            .:.|.:|.|:|..|:|..|...|:   |.|::..:..||   :.::|:|:..::.||.:.|..||
  Fly   138 IDQDADERITWKEYLQDTYAMEDE---DFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLT 199

  Fly   186 KDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREA 250
            .:||..|.:||:||.|..::|..|:.|.|.||||||:..|::||     .|...:.||:..|:|.
  Fly   200 LEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGD-----AASHHDKEWLITEKER 259

  Fly   251 FSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQ 315
            |....|.:.||.|..:||..||.|.:...:..|..||....|.||||:|:..|||:.||.||||:
  Fly   260 FDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSE 324

  Fly   316 ATDFGEAL 323
            |||:|:.|
  Fly   325 ATDYGDHL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 24/56 (43%)
EFh 206..273 CDD:238008 26/66 (39%)
EF-hand_7 248..308 CDD:290234 23/59 (39%)
EFh 248..306 CDD:298682 22/57 (39%)
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 16/52 (31%)
EFh 100..153 CDD:298682 16/52 (31%)
EF-hand_7 184..241 CDD:290234 24/56 (43%)
EFh 184..241 CDD:298682 24/56 (43%)
EFh 228..281 CDD:298682 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35792at33392
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 1 1.000 - - mtm1075
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.