DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and Rcn2

DIOPT Version :9

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_036122.2 Gene:Rcn2 / 26611 MGIID:1349765 Length:320 Species:Mus musculus


Alignment Length:325 Identity:113/325 - (34%)
Similarity:186/325 - (57%) Gaps:26/325 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLVVALTAVISGASASSIPEELPHNPLEHDPLHPRHFDGGEHNAQFDHEAFLGPDES-KKFDSL 72
            |||.:.|.|.::|||.:   |||             |:..|||.|.:|.||.||..|. .::..|
Mouse    12 LLLPLLLYAAVAGASKA---EEL-------------HYPQGEHRADYDREALLGVQEDVDEYVKL 60

  Fly    73 TPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQHNPDNNETISWDSY 137
            ..||.:|||..|:.:||.:.||.:|..||..||..:.:.|..::..:.:.:::.:::..::||.|
Mouse    61 GHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGAVTWDEY 125

  Fly   138 MQTVYGFMDDLSPDEK---EQEENGVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHP 199
            ...:|..:.|.  ||.   :..|.| |::.|..:|:.|:..|:||....|:.:||.||.|||:..
Mouse   126 NIQMYDRVIDF--DENTALDDTEEG-SFRQLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVD 187

  Fly   200 SMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLN 264
            .|...|::|.:.:.||:.||.:|::|::|| ||.....:|:|||:..|::.|....|.|.||.|:
Mouse   188 YMTEFVIQEALEEHDKNGDGFVSLEEFLGD-YRRDPTANEDPEWILVEKDRFVNDYDKDNDGRLD 251

  Fly   265 EEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 329
            .:|:..|:.|::...::.||.||:.|.|.:.|.||::||||:..|:|:.|:|||:|..|  ||::
Mouse   252 PQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATDYGRQL--HDDY 314

  Fly   330  329
            Mouse   315  314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 21/56 (38%)
EFh 206..273 CDD:238008 24/66 (36%)
EF-hand_7 248..308 CDD:290234 22/59 (37%)
EFh 248..306 CDD:298682 21/57 (37%)
Rcn2NP_036122.2 EFh 68..124 CDD:238008 14/55 (25%)
EF-hand_7 69..125 CDD:290234 14/55 (25%)
EF-hand_7 194..259 CDD:290234 23/65 (35%)
EFh 194..259 CDD:238008 23/65 (35%)
EF-hand_7 235..293 CDD:290234 21/57 (37%)
EFh 240..293 CDD:298682 20/52 (38%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 317..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.