DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and C56C10.9

DIOPT Version :10

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_495338.1 Gene:C56C10.9 / 183859 WormBaseID:WBGene00016965 Length:320 Species:Caenorhabditis elegans


Alignment Length:363 Identity:89/363 - (24%)
Similarity:143/363 - (39%) Gaps:97/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTAVISGASASSIP---------EELPHNPLEHDPLHPRHFDGGEHNAQFDHEAF----LGPDES 66
            |.|:...:||.|||         :.:...|||.|         ||.|.:|..|..    |.|.:|
 Worm     5 LLAIFMISSALSIPLNRSDFLENDHVELMPLEKD---------GELNDKFRQEMIFSHNLDPSDS 60

  Fly    67 KKFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIE----------------E 115
            |:......|        :..:.|.|.||.:|..|||..|......::|                :
 Worm    61 KQLSESIKE--------MFKKTDVNDDGFLTAGELKQQIRKNMEEHLEKSKNDSEIFFDIVDTNK 117

  Fly   116 DVGRVW--------KQHNPDNNETISWDSYMQTVYGFMDDLSPDEKEQEENGVSYKSLLKRDRYR 172
            |...||        |.|..|::::...|.:.:         .|...:.|      |.:..|    
 Worm   118 DGSIVWEEFEPHFSKMHEKDHSDSELMDVHTE---------DPHRVDDE------KRMFNR---- 163

  Fly   173 WSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDL----DKDHDGKISVDEYIGDMYRS 233
               :|...|..|.:.|:..|||||  .|.:|:|  |.:.||    ||::|..:|.|:::..:   
 Worm   164 ---SDITRDGRLDRMEWHIFLHPE--YSAQGLV--EIVNDLMGVYDKNNDEVVSQDDFVNGI--- 218

  Fly   234 TGAEDE-EPEWVANER-------EAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFE 290
            .|..|| .||:...|:       ..|:...|.:.||.....|:..::.|.:|..:..|...::..
 Worm   219 PGTVDELNPEFENMEKLEKERRLREFNEEIDENSDGKATFRELYDYVDPQNFRLASKEVNDIMML 283

  Fly   291 ADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDE 328
            .||::|:||:.||:|::..:...|.......:|  |||
 Worm   284 TDANNDEKLSLEELLERDWLLARSSLLSARSSL--HDE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EFh_CREC_Calumenin_like 45..313 CDD:320024 73/307 (24%)
EF-hand motif 45..74 CDD:320024 9/32 (28%)
EF-hand motif 80..109 CDD:320024 9/28 (32%)
EF-hand motif 116..145 CDD:320024 7/36 (19%)
EF-hand motif 168..197 CDD:320024 9/28 (32%)
EF-hand motif 205..234 CDD:320024 9/32 (28%)
EF-hand motif 247..276 CDD:320024 7/35 (20%)
EF-hand motif 283..313 CDD:320024 9/29 (31%)
C56C10.9NP_495338.1 EFh_CREC_cab45 35..289 CDD:320023 70/299 (23%)
EF-hand motif 35..65 CDD:320023 12/38 (32%)
EF-hand motif 66..95 CDD:320023 10/36 (28%)
EF-hand motif 105..134 CDD:320023 4/28 (14%)
EF-hand motif 156..185 CDD:320023 12/43 (28%)
EF-hand motif 193..222 CDD:320023 8/31 (26%)
EF-hand motif 240..269 CDD:320023 6/28 (21%)

Return to query results.
Submit another query.