DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scf and myd

DIOPT Version :10

Sequence 1:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_312103.4 Gene:myd / 1273151 VectorBaseID:AGAMI1_000071 Length:335 Species:Anopheles gambiae


Alignment Length:259 Identity:70/259 - (27%)
Similarity:119/259 - (45%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RIDENKDGSVTLAELKNWIAYTQRRYIEEDVGR-----VWKQHNPDNNETISWDSYM------QT 140
            :.|.|.|..:|:.||..:|.:..|.:|:|.:..     |...|.| .:..:|||.|.      |.
Mosquito    86 KADTNGDKHLTVQELAKFINFKIREHIDEAIRTNPIMFVEIDHKP-RDGLVSWDEYQGYWLRGQG 149

  Fly   141 VYG--FMDDLSPDEKEQEENGVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKG 203
            :.|  .|...:.|:.:::     .|..:.||:..|..|.:....:||.|||.:|.|||.......
Mosquito   150 IQGDSHMKKSAFDKLDRK-----VKESIARDKAHWMEAARTDPLSLTLDEFLSFRHPESSTVNLL 209

  Fly   204 VVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEE---PEWVANEREAFSTHRDLDKDGYLNE 265
            .::.:.:...|.|.|..::|:|: .|:..:...|.::   .:.|...||.|:...|.::||..:.
Mosquito   210 NLVDDILRQFDVDGDDHLTVEEF-SDVQTTDLGEGKKFILSQNVRERREEFTKVIDKNRDGKADR 273

  Fly   266 EEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 329
            .|:..::.|....::..||..|...|||:.|.||...|:|.|..:|:.|:.....|:.  ||||
Mosquito   274 GELLSYVDPRHPRYAIQEASTLFTLADANKDKKLLMHEMLAKSAIFISSKMVHTAESF--HDEF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scfNP_477392.1 EFh_CREC_Calumenin_like 45..313 CDD:320024 64/241 (27%)
EF-hand motif 45..74 CDD:320024
EF-hand motif 80..109 CDD:320024 7/21 (33%)
EF-hand motif 116..145 CDD:320024 9/41 (22%)
EF-hand motif 168..197 CDD:320024 12/28 (43%)
EF-hand motif 205..234 CDD:320024 6/28 (21%)
EF-hand motif 247..276 CDD:320024 8/28 (29%)
EF-hand motif 283..313 CDD:320024 13/29 (45%)
mydXP_312103.4 EFh_CREC 59..320 CDD:330175 63/240 (26%)
EF-hand motif 71..108 CDD:320021 7/21 (33%)
EF-hand motif 118..148 CDD:320021 7/30 (23%)
EF-hand motif 174..203 CDD:320021 12/28 (43%)
EF-hand motif 211..240 CDD:320021 6/29 (21%)
EF-hand motif 255..284 CDD:320021 8/28 (29%)
EF-hand motif 291..320 CDD:320021 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.