DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and VPS9D1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_005256386.1 Gene:VPS9D1 / 9605 HGNCID:13526 Length:632 Species:Homo sapiens


Alignment Length:128 Identity:43/128 - (33%)
Similarity:62/128 - (48%) Gaps:20/128 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 NSEARDLV---YNAISELVGIDSYYS-PQEKLQCTWRCCRHIFELLK------RAT--GGP---- 312
            |.||:...   |.|.::.:|:....| ||:||:|..|..|.|....:      .||  .||    
Human   499 NPEAKGATGYPYCAAAQELGLLVLESCPQKKLECIVRTLRIICVCAEDYCPTPEATPQAGPPPIA 563

  Fly   313 ---ASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENL 372
               ..|||.||.|.||||::...:|.|....:..|.:...|: ||.||..|:|.||::::|.|
Human   564 AAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFIHEGYLI-GEEGYCLTSLQSALSYVELL 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 39/115 (34%)
VPS9D1XP_005256386.1 VPS9 510..625 CDD:280383 39/115 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.