DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and MUK1

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_015255.1 Gene:MUK1 / 856035 SGDID:S000005991 Length:612 Species:Saccharomyces cerevisiae


Alignment Length:422 Identity:84/422 - (19%)
Similarity:160/422 - (37%) Gaps:105/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QLRIPDDGKRKLKL-EIQRLDSDIRKYMNGNGGKNINELSDLVQNAYTKVSDI------------ 192
            |:..|::.|::||: |:..:  .|.|||         ||.:  ::.:.|:..:            
Yeast   200 QMLSPEEIKKQLKINELNNM--KIEKYM---------ELCE--RDVFKKILIVGTSVSSPNKMKT 251

  Fly   193 --VHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFLFSPYFTTDEDSDVKVQKRIRQLSWITAKH 255
              .|...:|::. |..|:|       |..|:.:|.|........:.|.:.....|:.||......
Yeast   252 FKPHQLQTFKVG-NLFRNS-------VEFTEYNKLLNEKILCLSKLSTMNKINLIKFLSLNNGID 308

  Fly   256 LDCSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRATGGPASADDFLP 320
            .:...:|:.....:..|::|          ||.||::...:    :.|::..:.  ..|.||:|.
Yeast   309 PEPKFEEIKDILYEFTYHSI----------SPCEKIKALLK----LHEIMTYSQ--EMSNDDYLS 357

  Fly   321 ALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENLNGESLGVSSEEFE 385
            .||:.::...|..:..|..|:..|....:|:..|| :..|||.:|:.|:|.|.            
Yeast   358 LLIYYIITIVPRDIFLNAEFIRLFRYKKKLVETES-FALTNLEAALVFVEGLT------------ 409

  Fly   386 ALMSGQQPYSTPWESALLACESLHLISENMKRMEMLQKRNALISSGITSFEKELIDFQREVTERV 450
                 :..:|...:..|...|| .::..::.....|..:.|::.....:....|.|......:|.
Yeast   410 -----KNDFSNELQDKLTVNES-KILENSISSRVSLPSKTAIMHKNNGNNGSNLGDIVTPTIQRP 468

  Fly   451 D-----------TVIAKAPLNLLPIKTPAFLIGQARAHLLNESEAGHYQANMLHGGSLTSQSLTA 504
            |           ||...:..|         :||:.|::            ...|..:.::.:|.:
Yeast   469 DVTRSNSYDGFRTVFDSSLKN---------IIGKIRSY------------TPPHPNNTSNNNLHS 512

  Fly   505 AGGLVKPAAASKES-GLSLKDTS-MSSMGRLS 534
            :..|..|.::|:.| .||.:||: ||..|..|
Yeast   513 SNNLNIPRSSSQLSMELSNRDTTEMSRDGSRS 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 25/98 (26%)
MUK1NP_015255.1 VPS9 313..412 CDD:388595 28/132 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.