DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and VPS9B

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_196494.2 Gene:VPS9B / 830791 AraportID:AT5G09320 Length:437 Species:Arabidopsis thaliana


Alignment Length:412 Identity:118/412 - (28%)
Similarity:183/412 - (44%) Gaps:81/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKVVMTQNHKFLFSPYFTTDEDSDVKVQKR 244
            |.||:.:.|:.......|.:...::::.|:|.|..||.|||:    ||...|.::.:..:..:|.
plant    45 DAVQDFFYKMESAFRAHPLWSGCSDDELDNAGDGLEKYVMTK----LFPRVFASNTEDVISDEKL 105

  Fly   245 IRQLS----WITAKHLDCSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELL 305
            .:::|    :|:.::||......|..:..|   |..||..|:.|.:|::||.|..|||:.|..||
plant   106 FQKISLVQQFISPENLDIQPTFQNQTSWLL---AQKELQKINMYNAPRDKLMCILRCCKVINNLL 167

  Fly   306 KRAT----GGPASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAI 366
            ..|:    .....||.|||.||:|.:||||.:.|||:.::.|:...|:|: ||:||.|||:.||.
plant   168 LNASIASNQNEPGADQFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLV-GEAGYLFTNILSAE 231

  Fly   367 AFIENLNGESLGVSSEEFEALMS---------GQQPYSTPWESALLACESLHLISENMKRMEMLQ 422
            :||.|::.:||.:...:||..|.         |.|.|.|...:||..       :.|.||..|| 
plant   232 SFISNIDAKSLSMDEADFETKMKSAHARLSGPGSQSYQTDHGAALPT-------AHNTKRENML- 288

  Fly   423 KRNALISSGITSFE--KELIDFQREVTERVDTVIAKA-PLNLLPIKTPAFL-------------- 470
                |.:....||.  .|.:.         :|.|.|| |:..|..|..|.|              
plant   289 ----LHTKSTDSFSGTNETLS---------ETPIKKADPITDLENKGAATLLNDRSEATKIFQEY 340

  Fly   471 ------IGQAR----AHLLNESEAGHYQANMLHGGSLTSQSLTAAGGLVKPAAASKESGLSLKDT 525
                  :|..:    ..|||..:...::...|..|...:.|||..   :.|..|||   :|...|
plant   341 PYMFASVGDLKIGDVEDLLNNYKQLVFKYVCLSKGLGDATSLTPC---ISPLQASK---VSENHT 399

  Fly   526 SMSSMGRLSPLQQNVQPADHLF 547
            ::||  ......:..:..|:||
plant   400 TLSS--DFQTKSETDRSVDNLF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 46/102 (45%)
VPS9BNP_196494.2 DUF5601 24..88 CDD:407982 13/46 (28%)
VPS9 133..238 CDD:366977 47/108 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2750
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 1 1.000 - - FOG0002652
OrthoInspector 1 1.000 - - otm2483
orthoMCL 1 0.900 - - OOG6_102142
Panther 1 1.100 - - O PTHR23101
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2025
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.