DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and AT4G14225

DIOPT Version :10

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_680686.1 Gene:AT4G14225 / 827063 AraportID:AT4G14225 Length:125 Species:Arabidopsis thaliana


Alignment Length:46 Identity:16/46 - (34%)
Similarity:22/46 - (47%) Gaps:8/46 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSLRLGQQDLKCRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQT 53
            |||        |..||||:.|.|.:.|||.|:.:...|:..:...|
plant     5 PSL--------CIRGCGFFSTSQTKNLCSKCYNDFLKDESARYLAT 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:460313 11/22 (50%)
DUF5601 163..220 CDD:465668
VPS9 274..373 CDD:460489
AT4G14225NP_680686.1 zf-A20 6..29 CDD:460313 13/30 (43%)
ZnF_AN1 69..103 CDD:197545
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.