| Sequence 1: | NP_612093.1 | Gene: | Rabex-5 / 38144 | FlyBaseID: | FBgn0262937 | Length: | 696 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_680686.1 | Gene: | AT4G14225 / 827063 | AraportID: | AT4G14225 | Length: | 125 | Species: | Arabidopsis thaliana |
| Alignment Length: | 46 | Identity: | 16/46 - (34%) |
|---|---|---|---|
| Similarity: | 22/46 - (47%) | Gaps: | 8/46 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 PSLRLGQQDLKCRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQT 53 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rabex-5 | NP_612093.1 | zf-A20 | 17..40 | CDD:460313 | 11/22 (50%) |
| DUF5601 | 163..220 | CDD:465668 | |||
| VPS9 | 274..373 | CDD:460489 | |||
| AT4G14225 | NP_680686.1 | zf-A20 | 6..29 | CDD:460313 | 13/30 (43%) |
| ZnF_AN1 | 69..103 | CDD:197545 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||