DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and AT2G27580

DIOPT Version :10

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_180326.1 Gene:AT2G27580 / 817304 AraportID:AT2G27580 Length:163 Species:Arabidopsis thaliana


Alignment Length:59 Identity:20/59 - (33%)
Similarity:31/59 - (52%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QQDLKCRSGCGFYGTPQNEGLCSMCFREKFNDKQRK------LKQTGGETGPGSSSSVA 66
            |:...|.:.|||:|:...:.|||.|||:..:.:|..      |.|:....|..:||||:
plant     8 QEPRLCANNCGFFGSTATQNLCSKCFRDLQHQEQNSSTAKHALTQSLAAVGAAASSSVS 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:460313 9/22 (41%)
DUF5601 163..220 CDD:465668
VPS9 274..373 CDD:460489
AT2G27580NP_180326.1 zf-A20 11..34 CDD:460313 9/22 (41%)
ZnF_AN1 104..141 CDD:197545
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.