DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and rin3

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_001339622.2 Gene:rin3 / 799244 ZFINID:ZDB-GENE-030131-8871 Length:1048 Species:Danio rerio


Alignment Length:469 Identity:84/469 - (17%)
Similarity:169/469 - (36%) Gaps:145/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 REKFNDKQRKLKQTGGETGPGSSSS-----VATL--------------DRRSPQHAHLQG----- 80
            |.|.::||...:....|..|....|     ||:|              |.::||...:..     
Zfish   454 RRKLSEKQASEEPAQQEVNPEPEDSTQQVPVASLICLDDGVEERDKPMDPKTPQVQEVPAEESKV 518

  Fly    81 ---------KVEQQVRKPS-------DKEQDNLGTL-----QKKKFTAVLQKT----------LQ 114
                     :|..|.::|:       .|.|.:...|     |....|..|:.:          :.
Zfish   519 ANGAPMVTPEVASQPKRPNAPVPPPRKKRQSHCSNLSSSTPQNTTSTVPLKSSSPSPVRHSLCIN 583

  Fly   115 AGAQKITQQRGHVPD-------------PTEGQ--------FLLQLRQLRIPDDGKRKLKL-EIQ 157
            |...|::....:.||             .||.:        .|::.....:.|..|::|.: .:.
Zfish   584 ATHPKVSDVSLYSPDGGAPLDHDSYSTSSTEEEADANMATGALIKRTPTIMLDRAKQRLSMVSMA 648

  Fly   158 RLDSDIRKYMNGNG--GKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEKV--V 218
            .|.:.:..:||.:.  .|.|.|:|   ::..|...::|.:..:|.:.|.....|:.:..:::  :
Zfish   649 NLSNVLTGFMNADRKLQKRIVEMS---RDGNTYFGNLVKDYRAFTLDTMRKHTSSTEMLQEIRQM 710

  Fly   219 MTQNHKFLFSPYFTTDEDSDVKVQKRIRQLSWITAKHLDCSID-----EVNSEARDLVYNAISE- 277
            :||...:|.       :.:::   :.:::.:..:.:.|:..|:     .|....|:.|||.:.: 
Zfish   711 ITQLKSYLI-------QSAEL---QNVQETAAYSEEKLEIIIEAAICKSVLKPLREAVYNGLKDI 765

  Fly   278 -------------------------------------------LVGIDSYYSPQEKLQCTWRCCR 299
                                                       |..:...||||:|:....:.|:
Zfish   766 HSRAGNLKKLKENQQVVQGTTTTDLGVITSVPETPIMEKIQTRLGNLHQEYSPQKKIDLLLKTCK 830

  Fly   300 HIFELLKRATGGPA-SADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLC 363
            .|:|.:.....|.| .||||||.|::|:.:.|...|..::.::....:.: |..||..||.|...
Zfish   831 IIYESMSVGCPGRAHGADDFLPVLMYVLARCNITALLLDVEYMMELMDPA-LQLGEGSYYLTTTY 894

  Fly   364 SAIAFIENLNGESL 377
            .|:..|:|.:.:::
Zfish   895 GALEHIKNFDKQAV 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 84/469 (18%)
VPS9 274..373 CDD:280383 30/143 (21%)
rin3XP_001339622.2 SH2_RIN3 149..249 CDD:198258
VPS9 803..905 CDD:280383 30/102 (29%)
UBQ 942..1024 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.