DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and RIN3

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_079108.3 Gene:RIN3 / 79890 HGNCID:18751 Length:985 Species:Homo sapiens


Alignment Length:397 Identity:73/397 - (18%)
Similarity:142/397 - (35%) Gaps:91/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QNEGLCSMCFREKFNDKQRKLKQTGGETGPGSSSSVATLDRRSPQHAHLQGKVEQQVRKPSDKEQ 94
            :|..||:          |....:|.....|....|.|:  :...||...|.....|   .|.:.:
Human   479 ENAELCT----------QAMALETPTPGPPREGQSPAS--QAGTQHPPAQATAHSQ---SSPEFK 528

  Fly    95 DNLGTLQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPDD--------GKRK 151
            .:|.:|......:|:          .|.|..:....||.    :|.|...|..        ||.:
Human   529 GSLASLSDSLGVSVM----------ATDQDSYSTSSTEE----ELEQFSSPSVKKKPSMILGKAR 579

  Fly   152 LKLEIQRLDSDIRKYMNGNGGKNINELSDLVQNAYTKVSDIVHNDPSFEIATNEDRDSAIDFFEK 216
            .:|......|....::: |..|...::.:|.|:..:....:|.:...:.:.....:.|:.:..::
Human   580 HRLSFASFSSMFHAFLS-NNRKLYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQE 643

  Fly   217 V--VMTQ---------NHKFLFSPYFTTDEDSDVKVQKRI------------------------- 245
            :  :|||         ..|.|..|...::|:.:..|:..:                         
Human   644 IRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGS 708

  Fly   246 ------RQLSWITAKHLD----CSIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRH 300
                  .||..:.....|    .|:.||     .::...:.:...:...|||::|:....:.|:.
Human   709 LQQLKENQLVILATTTTDLGVTTSVPEV-----PMMEKILQKFTSMHKAYSPEKKISILLKTCKL 768

  Fly   301 IFELLKRAT-GGPASADDFLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCS 364
            |::.:.... |.|..||||||.|::|:.::|...:..|:.::....:.: |..||..||.|....
Human   769 IYDSMALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPA-LQLGEGSYYLTTTYG 832

  Fly   365 AIAFIEN 371
            |:..|::
Human   833 ALEHIKS 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010 3/9 (33%)
VPS9 274..373 CDD:280383 26/99 (26%)
RIN3NP_079108.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SH2_RIN3 52..153 CDD:198258
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..293
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..531 13/66 (20%)
FtsZ_alphas_C 315..414 CDD:274601
Interaction with RAB5B. /evidence=ECO:0000269|PubMed:12972505 587..732 18/145 (12%)
VPS9 740..842 CDD:280383 26/101 (26%)
UBQ 882..961 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.