DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rabex-5 and rin2b

DIOPT Version :9

Sequence 1:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_017212050.1 Gene:rin2b / 565615 ZFINID:ZDB-GENE-030131-7043 Length:899 Species:Danio rerio


Alignment Length:445 Identity:99/445 - (22%)
Similarity:175/445 - (39%) Gaps:87/445 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKFNDKQRKLKQTGGETGPGSSSSVATLDRRSPQHAHLQGKVEQQVRKPS-----DKEQDNLGT- 99
            :::..::.|.:.:.|::  .|:||..:||  ||.|....|.|.|.:....     |:|:::.|. 
Zfish   409 QQWTGQEEKGRSSSGQS--LSTSSSDSLD--SPPHPLPLGHVSQGLSTDDSTDDYDEEEEDYGVG 469

  Fly   100 ----LQKKKFTAVLQKTLQAGAQKITQQRGHVPDPTEGQFLLQLRQLRIPDDGKRKLKLEIQRLD 160
                ||.:...:...|.|.|.....|:.|..|.......|......|.:....::::.|:|..|.
Zfish   470 LERDLQLRLRASRKSKKLLAVELVGTRPRSLVLPRALRHFRKVRGVLNVLATPEKRILLQIIELS 534

  Fly   161 SD--------IRKYMN-GNGGKNINELS-DLVQ---------NAYTKVSDIVHNDPSFEIATNED 206
            .|        ::.|:: ....||.:..| ||:|         .||.|.|.  ..:|..|....||
Zfish   535 QDKGSYFGCLVQDYVSFVQENKNCHSSSQDLLQTIRQFMTQMKAYLKQSS--EMNPPIESYMPED 597

  Fly   207 RDSAIDFFEKVVMTQNHKFLFSPYF------------------TTDEDSDVKVQKRIRQLSWITA 253
            :...:  .||.:    ||.:..|.:                  |..|:..:...||..:|....|
Zfish   598 QIDPV--LEKAM----HKCVLKPLYGCLHSALHEFQAAAGVWQTLQENLAIAKTKRPNELGVNGA 656

  Fly   254 KHLDC-SIDEVNSEARDLVYNAISELVGIDSYYSPQEKLQCTWRCCRHIFELLKRATGGPASADD 317
            :..|. :|..:..:.|.:.           |.|||:.|:....:.|:.|:.:::........|||
Zfish   657 QAPDTHAIQRIRRKLRAMC-----------SMYSPERKIMVLLKVCKLIYSIMQEHEVRMFGADD 710

  Fly   318 FLPALIFVVLKANPVRLHSNINFVTRFTNASRLMSGESGYYFTNLCSAIAFIENLNGESLG--VS 380
            |||.|.:|:::.:..:|.:.|.::....:.. |:.||.|||.|:...|::.|:|...|...  :|
Zfish   711 FLPMLTYVLVQCDMPQLDTEILYMMELIDPP-LLHGEGGYYLTSAYGAMSLIKNFQEEQAARILS 774

  Fly   381 SEEFEALMSGQQPYSTPWESALLACESLHLISENMKRMEM-LQKRNALISSGITS 434
            |...:.|..        |........:|..:.:....|.: |||.:    ||.|:
Zfish   775 SATSDTLHQ--------WHQRRTLQRNLPSVDDFQNYMRVALQKAD----SGCTA 817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rabex-5NP_612093.1 zf-A20 17..40 CDD:280010
VPS9 274..373 CDD:280383 27/98 (28%)
rin2bXP_017212050.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.